SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119384158|ref|YP_915214.1| from Paracoccus denitrificans PD1222

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|119384158|ref|YP_915214.1|
Domain Number - Region: 10-60
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00549
Family GntR ligand-binding domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119384158|ref|YP_915214.1|
Sequence length 110
Comment preprotein translocase subunit YajC [Paracoccus denitrificans PD1222]
Sequence
MLVTPAYAQAAGGASGAAGLASFLPLILIFVIMYFLMIRPQQKRMKEHRAMVEALKKGDE
VITQGGLIGKVTSVREGELEVEIAPGVKVRVIRSTVTGLVNRTQPAAANS
Download sequence
Identical sequences A1B1X4
WP_011747736.1.25907 WP_011747736.1.3707 WP_011747736.1.52749 318586.Pden_1417 gi|119384158|ref|YP_915214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]