SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119385049|ref|YP_916105.1| from Paracoccus denitrificans PD1222

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119385049|ref|YP_916105.1|
Domain Number 1 Region: 91-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.93e-36
Family Phosphate binding protein-like 0.0019
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.67e-23
Family LysR-like transcriptional regulators 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119385049|ref|YP_916105.1|
Sequence length 305
Comment LysR family transcriptional regulator [Paracoccus denitrificans PD1222]
Sequence
MHLELRHLRSLRAIHEQGGLARAAEVLNLTQSALSHQIKALEEQAGVELFLRKTKPLRLS
AAGMRLLRTAEQVLPLIEAAEADFRAVELGRAGRLHVAMECHHCFDWLLPVLDQFRRAWP
EVDLDIRSSLALKALPALQRGQVDMVISSDPEELAGITFQPLFDYAPTMVVAAGHRLAAK
GYAEPADLAGETLITYPMDRARLDVFSQFLDPAGVEPAHLRQVEQTAIALMLIASGRGVA
VMPDWVLRAQAGNPELALLPLGRQGMLRRLYAALRTEDLQQPYMAHVLRLARTEPVRMMR
ALAQG
Download sequence
Identical sequences A1B4G5
WP_011748602.1.25907 WP_011748602.1.3707 WP_011748602.1.52749 318586.Pden_2318 gi|119385049|ref|YP_916105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]