SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119385794|ref|YP_916849.1| from Paracoccus denitrificans PD1222

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119385794|ref|YP_916849.1|
Domain Number 1 Region: 155-283
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.66e-20
Family GntR ligand-binding domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 3-71
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000009
Family GntR-like transcriptional regulators 0.048
Further Details:      
 
Domain Number 3 Region: 84-145
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000108
Family GntR-like transcriptional regulators 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119385794|ref|YP_916849.1|
Sequence length 290
Comment GntR family transcriptional regulator [Paracoccus denitrificans PD1222]
Sequence
MARVSLSPQIIARIVDHARAQNMQAGQHLPAQLLADSFKVSRQPIVSALKKLEQMGIVQS
EPNRGYFLACNADEIPEMDTDAAADDALYDRIAADCLARRLPDRLSENELMRLYGVARGR
LLRVLHQIADEGWIERLPGNGWEFREILTSRKAYSEAYQFRAAIEMQALLLPSFRIDQAA
FADARRHQQELLASYESESRQKVFGTNIEFHEMLMTCASNEFFLDAVRRVNRVRRLMEYS
ITHDRSRLPQQCREHLQILDLIEQRDMQAAATFLYSHIREAGNIKAALFE
Download sequence
Identical sequences A1B6K9
318586.Pden_3072 gi|119385794|ref|YP_916849.1| WP_011749340.1.25907 WP_011749340.1.3707 WP_011749340.1.52749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]