SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119386144|ref|YP_917199.1| from Paracoccus denitrificans PD1222

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119386144|ref|YP_917199.1|
Domain Number 1 Region: 74-206
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.7e-23
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 6-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000546
Family GntR-like transcriptional regulators 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119386144|ref|YP_917199.1|
Sequence length 216
Comment GntR family transcriptional regulator [Paracoccus denitrificans PD1222]
Sequence
MSISSNLSQEAHRRIIGMIFEGALKSGDALQEAPLGERLGMSRTPVREAIKRIESEGLAE
TSGRFTRVRHMRRSEFEEIFFLRLQLEPFAARAAVRLPPAQVDAMEERIRRLMAAGPELD
GSHFQTDNDFHDMMLQPLGNRTISAVVASLRRRTCVFDHTQVPDRFLQGCDEHLDILNAV
RSGNADAVATGMVRHLENARDAVLDRLDRISAETAP
Download sequence
Identical sequences A1B7K9
WP_011749681.1.25907 WP_011749681.1.3707 WP_011749681.1.52749 gi|119386144|ref|YP_917199.1| 318586.Pden_3432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]