SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119383574|ref|YP_914630.1| from Paracoccus denitrificans PD1222

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119383574|ref|YP_914630.1|
Domain Number 1 Region: 182-342
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.81e-32
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.0028
Further Details:      
 
Domain Number 2 Region: 642-803
Classification Level Classification E-value
Superfamily beta-Roll 6.02e-26
Family Serralysin-like metalloprotease, C-terminal domain 0.00058
Further Details:      
 
Domain Number 3 Region: 533-649
Classification Level Classification E-value
Superfamily beta-Roll 1.05e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.00065
Further Details:      
 
Domain Number 4 Region: 354-507
Classification Level Classification E-value
Superfamily beta-Roll 6.93e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.0000526
Further Details:      
 
Domain Number 5 Region: 46-141
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000615
Family Collagen-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119383574|ref|YP_914630.1|
Sequence length 820
Comment peptidase domain-containing protein [Paracoccus denitrificans PD1222]
Sequence
MTLTGRNLTFADAAGTTLHETAAVARAVRTEGGDAPAGRSTGYAMAVGDTFNGTLSAGDR
DWVRVELQPGSYVITLDSRGAAGVYDPYLRVMDDDGVQVAQNDDGDGLNSRLVLNVAQPG
TYYLEAGSYAGLYSGAYSLNLAATGPTHHFTMAEIALQLTDGYWEATGRSRRAFDVGQGD
VLNVDLSGLTQEGRQLAGMALSAWAQVTGIVFNRNPGTNATIHITFDDSDWGAWSSSMTS
GDRIVSSHVNIGLDWLISYGTGYNSYSYQTYIHEIGHALGLGHAGNYNGSAVLGVNNHYL
NDSWQASVMSYFDQAENVWVDASFAYIASPMTADILAIQRLYGPTAIRTGNNTYGETTNA
GPSYATIAALLRNADTRDDIAFTIFDQGGVDMLDLGTDTRGQRISLVAGTSSNAYGLVGN
ISIMPGTLIENAQAGRGNDLVIGNWADNILRGGAGNDTLRGAAGNDTLNGQGGADRLVGG
VGDDVYVTDGRDQIVEAAGQGIDTVRSTVTLQLGANLENLVLISNAAQDGGGNALANRLT
GNAHANRLEGFSGNDTLLGGQGNDTLYGGNGWDVLGGGAGADLLIGGNGNDILRGWTGND
TLRGGAGNDTLNGQGGADRLEGGAGDDVYVTDGRDQIVEAAGQGIDTVRSTVTLRLGANL
ENLVLISNAAQDGSGNGLANRLTGNAHANRLEGFFGNDTLLGRQGNDLLFGGQGDDWLEG
GAGADLLVGGQGDDTMLGGAGADHFVFQGGRDVVGDFQDDLDTLRIDDALWGGGPRSVAQ
VLQLAHVAGGNTVFDFGNGNVLTLNGFANIAALQDDLIIV
Download sequence
Identical sequences A1B090
318586.Pden_0822 WP_011747162.1.25907 WP_011747162.1.3707 WP_011747162.1.52749 gi|119383574|ref|YP_914630.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]