SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119384172|ref|YP_915228.1| from Paracoccus denitrificans PD1222

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119384172|ref|YP_915228.1|
Domain Number 1 Region: 78-204
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-20
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.26e-18
Family GntR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119384172|ref|YP_915228.1|
Sequence length 222
Comment GntR family transcriptional regulator [Paracoccus denitrificans PD1222]
Sequence
MKHAPEETQSARIARVLADRIISGEIPPGARLRQDHIAAEFGASHVPVREAFRELQTQGL
AESQPRRGFRVTEFDVAELREVAEMRSSLESLALRHASPNMTRAILQEAEEVTRHGDNAS
TVRDWEAANRHFHRIILSPCRMPRLLRTIDDLQAASARFLFAAWRRDWEARTDHDHRAIL
DALRKGQTDLACATLARHVGWIGKRKTAVKNADLRETYEIPG
Download sequence
Identical sequences A1B1Y8
318586.Pden_1431 WP_011747750.1.25907 WP_011747750.1.3707 WP_011747750.1.52749 gi|119384172|ref|YP_915228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]