SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|120401320|ref|YP_951149.1| from Mycobacterium vanbaalenii PYR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120401320|ref|YP_951149.1|
Domain Number 1 Region: 104-232
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.02e-22
Family GntR ligand-binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 15-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5e-20
Family GntR-like transcriptional regulators 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120401320|ref|YP_951149.1|
Sequence length 236
Comment GntR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1]
Sequence
MNAPGGEAIPPLIRRPQSVSVALAAHFERLIATGEISPGTRLPSERELAASMSVSRSSLR
EAMHELESKRLVSRTRGRGTIVLAPTASVDELLAIAGGGTEQEHAAELRSVIEPSIAELA
AHRATSANVLQLRDVLDKSHENLLQAESLRLDIEFHLLLAQAAQNPLLTALQTLASEWTG
EVRKHSHSTRHGRCASVRGHQEIFDAVRTHDGLAARQAMEDHLRDVSELVAKATRS
Download sequence
Identical sequences A1T1U3
WP_011777616.1.45031 WP_011777616.1.58012 350058.Mvan_0294 gi|120401320|ref|YP_951149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]