SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|120403673|ref|YP_953502.1| from Mycobacterium vanbaalenii PYR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120403673|ref|YP_953502.1|
Domain Number 1 Region: 10-223
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.04e-64
Family D-ribulose-5-phosphate 3-epimerase 0.00000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120403673|ref|YP_953502.1|
Sequence length 234
Comment ribulose-phosphate 3-epimerase [Mycobacterium vanbaalenii PYR-1]
Sequence
MSGPLAREAKKSPLIAPSILAADFARLAEETAAVEGADWLHVDVMDNHFVPNLTLGLPVV
ESLLKATDIPMDCHLMIENPERWAPPYAEAGAYNVTIHAEATDNPVAVARDIRAAGAKAG
LSVKPGTPLEPYLQILREFDTLLVMSVEPGFGGQKFIAEVLPKVGIARRLVDAGELTIVI
EIDGGINADTIEAAAEAGVDCFVAGSAVYSAQDPAAAVHSLRKQAASASKHLTL
Download sequence
Identical sequences A1T8J6
WP_011779904.1.45031 350058.Mvan_2689 gi|120403673|ref|YP_953502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]