SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120404184|ref|YP_954013.1| from Mycobacterium vanbaalenii PYR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120404184|ref|YP_954013.1|
Domain Number 1 Region: 9-195
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.83e-49
Family Methylesterase CheB, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120404184|ref|YP_954013.1|
Sequence length 258
Comment CheB methylesterase [Mycobacterium vanbaalenii PYR-1]
Sequence
MTVTSTDDPLRGVVAIGGSAAGVEALSRVAAGLPEDLPFAVLMALHLPEQGPSVLAQIID
RAGPLPAVAAENGATLEPGRIYVAVPGRHLLTRDHRIVLSNGPSESGHRPALNALFRSVA
VSFGPRAIGVLLSGVLDDGVLGLAAIRARGGTTLCQSPDDALFAAMPSNALRAGVVDRTA
VAADMGAVLMGLARRGSSGHAKSTDAYLELENHIAMTEPLAELDLQTLGPPSGFTCPDCN
GSLLTVADGYYRCHIGHA
Download sequence
Identical sequences A1TA07
350058.Mvan_3206 gi|120404184|ref|YP_954013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]