SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|239616417|ref|YP_002939739.1| from Kosmotoga olearia TBF 19.5.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239616417|ref|YP_002939739.1|
Domain Number 1 Region: 277-541
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-63
Family Tandem AAA-ATPase domain 0.0000000965
Further Details:      
 
Domain Number 2 Region: 480-687
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-40
Family Tandem AAA-ATPase domain 0.00000498
Further Details:      
 
Domain Number 3 Region: 107-273
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.34e-40
Family RecG "wedge" domain 0.0000245
Further Details:      
 
Domain Number 4 Region: 2-93
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.000000000392
Family RecG, N-terminal domain 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|239616417|ref|YP_002939739.1|
Domain Number - Region: 712-766
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.063
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|239616417|ref|YP_002939739.1|
Sequence length 787
Comment ATP-dependent DNA helicase RecG [Kosmotoga olearia TBF 19.5.1]
Sequence
MLLEDYLDRCEKLLEKFLSGKVDTIELIQEIKRGAELLEPEELSANEGLKDYIGKFVSYY
LPLASLPNERQHLRVKNGFTMINKLRGKFLLTSFDESTSAIPVKVSSLNFDIKYAKGVGE
RRAKILKKLGIETVKDLLWWLPRDYEDRRRIVPLSSIVADRKVTIRAKLQNFSVKKVKEY
VIISAVVSDGFGQIILKWFNQEYITDRLIKEREYLITGIPKKTPFGPYEMNSPEIEEITG
RVPREILPLYSLSAGISQKVMRKIVRKNITNVRLLKEFIPAEVIKERNLLPRHHAMYTVH
FPKSLYELKESRRRLAYEELFLFEVAVLYNREKLKTTKGGISKSISGKLAERFIDSLNFV
LTGDQMRAFEEIREDMKAPTPMNRLLQGDVGSGKTVVAELAIIDNFEAGYQSAMMVPTTV
LATQQHQKLVKDLEPLGIKVELLVGSQKKSQQEEIKKRIAIGEVDVVVGTHALIQENVKF
KDLGLVIIDEQHRFGVKQREALMNKGALVDTLVMTATPIPRTLALTAYGDLDISTITEMP
PGRAPIRTMLISEKRLPELYAFIRDEVNHGHQAFFIYPLIEESEQMDLKAATDEAERLQK
EVFPDIGVELLHGRMSDEEKNRIMHRFKNKEAMILVSTSVVEVGIDIPTATVMVIEHPER
FGLAQLHQLRGRVGRSSLKSYCMLVLNSNISGEALDRLRKFAGTQNGFKLAEIDLSLRGP
GEFMGTRQHGLPDFLVADIVKDSELLIMARNDAMELLKRDPNLEKHNRIIEEIKERFGEN
ISLIEVG
Download sequence
Identical sequences C5CH96
WP_012744523.1.19116 WP_012744523.1.82044 gi|239616417|ref|YP_002939739.1| 521045.Kole_0006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]