SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226311395|ref|YP_002771289.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226311395|ref|YP_002771289.1|
Domain Number 1 Region: 6-204
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000114
Family Carboxylesterase/thioesterase 1 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226311395|ref|YP_002771289.1|
Sequence length 225
Comment hypothetical protein BBR47_18080 [Brevibacillus brevis NBRC 100599]
Sequence
MVYPKTGSVIVRDGREMTYTHIQANQTPSRSVCFFFPGASYSFDRPYLYYSTMLFLNKQI
DLVHVLANYGRENTDLWNRSFGERSAWISEEMQTVVSRVLDVHEYERVFFLGKSLGTVPI
TCGLLKESRFARSSAILLTPLLAEDVFHAELLNLTQQIFLVSGTADHYYNQGVVDQLATS
KPNIQLHLPQNAKHSLDVDLCVDDSLQVLQSVMGELASFLDKQMD
Download sequence
Identical sequences C0ZAH6
358681.BBR47_18080 gi|226311395|ref|YP_002771289.1| WP_012685528.1.45054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]