SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226313376|ref|YP_002773270.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226313376|ref|YP_002773270.1|
Domain Number 1 Region: 867-969
Classification Level Classification E-value
Superfamily Collagen-binding domain 8.76e-21
Family Collagen-binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 759-845
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000732
Family Collagen-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226313376|ref|YP_002773270.1|
Sequence length 981
Comment microbial collagenase precursor [Brevibacillus brevis NBRC 100599]
Sequence
MKKESTKAMNRSWISMVTAGSIAISTVAAGLPLAAQAKSTQQTPSQEPIDSQIGHTPVQE
NMSKAQLRQAAKQEKYSISHLKTLDNSELVELLKEISWTQIPELFTYNDDTQEFYEDRER
VQAIIDALQESGKNFTKDDEQGIHTYVEVLRSGYYLGYYHDELKYLMEPKYKQKIIPALQ
AITANQNFAFGTKTQNEIISSTGKLISNTTVDSETIGTLSKVMEDFNDNRDKWSDDRVAS
EAFYSVLQGIGYVLIWGVDDSGRDELKGNIDAFLDPIFDMAENGETSADHVWLTNNALYY
TGKLGSYYSDPDKANDILTNAMKTYKKMSEPYFTAAQQIAEAYGEDANGKKIDLEEMVKE
GKKHYLPQQFTFDDGAVVFKTGDKLTEEQVERLYWASKEVKAQFHRVIGNDKELESGNPD
DVLTIVIYNTPDEYKINRFLYGYDTDNGGIYIEGTGTFFTYDRTKEQSIYSLEELFRHEF
VHYLQGRYEVPGMWGQGKIYENSRLPWYEEGGAEFFAGSTRTEGIKPRQSVVGNIRNAAP
YLDYTAADMMHAKYGTLAFYDYSFALQYHLFKNDFARLDKINDTIRSNDVSAYDDLIEEF
SRDRALERGYQETLEDLIDQYEELDVPLVSDDYLQKADVTNKEEVYRQIAKVASLVDVKT
DEKDSGDFRSFTLRGVYTGGASQGEYQDWQEMNRLTDGFLKELSDLSWNGYDTVTSYFTN
YRTTKDGRFAYDVVFHGKLAQEDGSETEQPNPNPEESSLSLGKPITGIIHPQKPSQEFRL
DVKSAQQLQVEMETKQGDGVAWLVFHEADRENYISYPTKREGNKLIGSFDAKPGTYYVTA
YTYRTEQEDQPFRLLVTGEDRPQEQLYQENESNDSTEQANGPLKIGTTVSGDMKGNDWQD
IFAFQVDKPEEIRISLNPQEGQGVTWMLFHEGNLDQPVTYPQEREGNLQSAHYQVKPGRY
FLYVYKYQNEDIVYTVETKQR
Download sequence
Identical sequences C0ZG57
358681.BBR47_37890 gi|226313376|ref|YP_002773270.1| WP_015892050.1.45054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]