SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226314007|ref|YP_002773903.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226314007|ref|YP_002773903.1|
Domain Number 1 Region: 6-271
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.9e-60
Family Carbon-carbon bond hydrolase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226314007|ref|YP_002773903.1|
Sequence length 277
Comment pimeloyl-CoA synthesis protein [Brevibacillus brevis NBRC 100599]
Sequence
MENRQSVQTGFLEANGARIYYEVAGEGEPLLLIHGFNLDTRLWDAQLQAFAQTYKVVRFD
IRGFGKTLATDVPYTLYDDVKAVLQGLGIEKAHVAGLSFGGMVAQEFALAYPQMVNSLIL
VASGLFGHPRSEQRLHDVERFNQVCQRGTTEEALEMTTQMWFDGPGQPVNEQAREARNRF
KEINRHAFSLPEFGVGLETLSPSPIERLEEIKAPTLVIAGGRDYPDFLQIADVLGERITG
AKKVILPDSAHIPPMDQPEVFNKLVLEFLAQNIVKSS
Download sequence
Identical sequences C0ZJ24
WP_015892661.1.45054 gi|226314007|ref|YP_002773903.1| 358681.BBR47_44220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]