SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226314319|ref|YP_002774215.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|226314319|ref|YP_002774215.1|
Domain Number - Region: 61-131
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00114
Family Collagen-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226314319|ref|YP_002774215.1|
Sequence length 148
Comment hypothetical protein BBR47_47340 [Brevibacillus brevis NBRC 100599]
Sequence
MIDLKKFAQAALLALLTASFIIPTGAEAASSQQTSNTVAPASTKQVADYSNLGSNDPTKK
SATFNVTTPGYVTVNVTQNHGTETAYMYYAIVTDLPDGTTTSYGASNIEGNGSFSFTSSK
PLPAGEYYIRYNSKQRGRTSGTISVTTP
Download sequence
Identical sequences C0ZKN4
358681.BBR47_47340 gi|226314319|ref|YP_002774215.1| WP_015892972.1.45054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]