SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226314873|ref|YP_002774769.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226314873|ref|YP_002774769.1|
Domain Number 1 Region: 33-140
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000706
Family Collagen-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226314873|ref|YP_002774769.1|
Sequence length 154
Comment hypothetical protein BBR47_52880 [Brevibacillus brevis NBRC 100599]
Sequence
MKKKLLVGLSSLVLSLTVASSVFAASYWETETNQQSNNTWSQRDANGFVLGIGDVAQGYI
WDIDDEDYVAFYPKTSGTRTIRLNVPSNMDLKFEIWDAARNKVLDESISNKNGVGGAESV
TMYFSAQKYYILIDRVSKSGAEGNTTNGYALSIQ
Download sequence
Identical sequences C0Z6R6
358681.BBR47_52880 gi|226314873|ref|YP_002774769.1| WP_015893514.1.45054 WP_015893514.1.78400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]