SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226315159|ref|YP_002775055.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|226315159|ref|YP_002775055.1|
Domain Number - Region: 33-132
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00131
Family Collagen-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226315159|ref|YP_002775055.1|
Sequence length 145
Comment hypothetical protein BBR47_55740 [Brevibacillus brevis NBRC 100599]
Sequence
MKHSFKRILSSCMVLAALAMGTQSAFASDGYGDTQDKAVPIKIYKPMSHTISDSNDVDWY
EYDNRSGQSISVLLESPQNQNYDFDLVYISANGKVHETYKPNDFGPGGSDVLGLQIGLGD
QVYIKVYGHSASDFDKNNPYKLTIN
Download sequence
Identical sequences C0Z8C4
WP_015893742.1.45054 gi|226315159|ref|YP_002775055.1| 358681.BBR47_55740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]