SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226315099|ref|YP_002774995.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226315099|ref|YP_002774995.1|
Domain Number 1 Region: 448-463,540-798
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.41e-25
Family Bacterial lipase 0.094
Further Details:      
 
Domain Number 2 Region: 332-434
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000262
Family Collagen-binding domain 0.0092
Further Details:      
 
Domain Number 3 Region: 207-309
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000471
Family Collagen-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226315099|ref|YP_002774995.1|
Sequence length 933
Comment esterase [Brevibacillus brevis NBRC 100599]
Sequence
MGIITRRLLCVLLLFALCLGNTVEQGWAKEREIFVEEAWAWIDEGEVRFQAQLSGTPDKV
ELSVSQGSVSKIRSFHEESQISLAVMPMDDSPIQITMSIDDAEGPLRSWELSLPEHIEPT
VEIIKIKKAPWDEMGSDQEEPLTLVEREGEDKNKNEAPAEEAEHKQDQDQDASDEELSRL
AEEFYAHFSSENKPGEAELRNREVRFEVEPNDTLGSKSDWLFDGKDSHGKISSKDDVDFW
KIRGTTKGQMNISLTDIPANEDYDLYVYDEGEGELARSEQHGNESELIEGLTLEKDKWYY
IKVVGKQGSFSKNYYYRLRADFSADHGGGGKADGYEPNDTREAAYKLDAYNRKIVGNLHS
KTDVDFYSLSFPLSSTVEVSLKDIPTGMDMDVFLLDEAGKVVASSAKAKNSDEHIIFNAY
PGTYIVKVMASKRSGFTANSYSLYIGDRTIPVILIPGVGGSRLEVEQNGKRSEIWLGLGD
SLIGINDPKHRRLLSLEPIKPNSIDVQPVARDATIHPEKDDFYAIEYLSYAPFLKELTEQ
YYSMVKELEKAGYKKHRTLFALPYDWRYSSTKNAKLLKEKIDAALKASGANQVHLVAHSM
GGLLVKETLLSNVSYQRKVNRVVYMGTPFLGSPRAYQALKHGYNFSIPWLDEETGKVISS
YAPAVYELLPSKKYFESVGFLKRSNIQYYTYDDFLKDKNIRLDYAPLVRHGGQMHEKWDN
KTINVPQYSIVGTGQVTLLGYFYDSFYNEWSPILDPGVGDGTVPYMSANYAQKDMKKRYY
VKGEHAKLPTIPEVIDQVTRLLQGDDELQPGLRNAPDQNADYLYYIIAQDDKSFPEVTIH
KSGQTFTLDVNKKEVREDLSIEYHDRIVVIHVRDGEDLEFQPPVAVEGAEPARFLIKRFS
SDDSERYKETGRRYVLDERGLAEVEQTTDSNDV
Download sequence
Identical sequences C0Z864
gi|226315099|ref|YP_002774995.1| WP_015893682.1.45054 358681.BBR47_55140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]