SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256824776|ref|YP_003148736.1| from Kytococcus sedentarius DSM 20547

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256824776|ref|YP_003148736.1|
Domain Number 1 Region: 8-157
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-43
Family Ribonuclease PH domain 1-like 0.000000389
Further Details:      
 
Domain Number 2 Region: 335-506
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.34e-42
Family Ribonuclease PH domain 1-like 0.00000061
Further Details:      
 
Domain Number 3 Region: 488-587
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.44e-25
Family Ribonuclease PH domain 2-like 0.0000164
Further Details:      
 
Domain Number 4 Region: 158-267
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.28e-24
Family Ribonuclease PH domain 2-like 0.0000142
Further Details:      
 
Domain Number 5 Region: 590-702
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.59e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 6 Region: 272-358
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000167
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256824776|ref|YP_003148736.1|
Sequence length 842
Comment polynucleotide phosphorylase/polyadenylase [Kytococcus sedentarius DSM 20547]
Sequence
MEGPEITTAEAVIDNGAYGTRTIRFETGRLAQQAAGSVAAYLVEDDIDDATMVLSTTTAG
KEPKDHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPGTDAILTCRLIDRPLRPTFTKGL
RNEVQVVVTVLAHHPDHQYDVLAINAASASTQISGLPFSGPIGGVRISLIDGQWVAFPNF
SDIARSTFDMVVAGRLTDDGDVAIMMVEAESTESTWALVNDEGKTAPTEEVVSQGLEASK
VFIRALCEAQASLHAAAGKEVQEFPTFLDFQDDAYQAVESAAEKNTAEALTIAGKQEREG
RLDEIKDSLKADLAGADEESGKPFAGRAKEVSAAFKALQKKLIRERILRDGVRIDGRGPK
DIRALSAEVQALPRVHGSAIFERGETQIMGVTTLNMLRMEQQLDGLNPVTRKRYMHNYNF
PPYSTGETGRVGSPKRREIGHGALAERAILPVLPSREEFPYAIRQVSEALGSNGSTSMGS
VCASTLSLLNAGVPLKAPVAGIAMGLVSAQVDGGTRYQALTDILGAEDAFGDMDFKVAGT
KDFVTAIQLDTKLDGIPAEELSKALTQAREARLHILDVMSQAIDAPDEMSPNAPRVIAVK
VPVDKIGEVIGPKGKMINQIQEDTGADISIEDDGTVYIGATDGPSAEAARSAVNAIANPQ
MPEIGERFLGTVVKTTTFGAFISLLPGKDGLLHISEIRKLVGGKRIDAVEDVLNVGDKVQ
VELKEIDQRGKLSLGAVVAEDGEAAAQAPQSGKIGGGSADRGAADATSVEDDAERPAPVT
VENSITDDDALEAQEATQSAVDGEGSDSSDDSEDEGGERRRPRRRRGARGGRARGGSEGS
ED
Download sequence
Identical sequences C7NFX1
WP_012802386.1.81216 gi|256824776|ref|YP_003148736.1| 478801.Ksed_09250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]