SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256825493|ref|YP_003149453.1| from Kytococcus sedentarius DSM 20547

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256825493|ref|YP_003149453.1|
Domain Number 1 Region: 18-271
Classification Level Classification E-value
Superfamily Cgl1923-like 1.96e-73
Family Cgl1923-like 0.00000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256825493|ref|YP_003149453.1|
Sequence length 348
Comment hypothetical protein Ksed_16730 [Kytococcus sedentarius DSM 20547]
Sequence
MQDPSELFRIEDPADIDPRSVRTDTLWLATGGLVDAGDVEKNAVAHVLSTMESRVVASFD
VDALLDYRARRPLLTFQRDRYISVDMPSLVVHRVTDPNGRHFLLLNGPEPDYQWERFLMA
LLMLAQEFGVRTLVSANGAPMQVPHTRPTGLTAYASDERLIADHASVFGTMQVPGHVDGL
AHVRFAEAGIDTIGFAIHVPGYLADREMLDGTVAALHAISEATGIEVPMDDLEKRAEVNR
RELDELVESNPEALEVVRTMEQQFDEFMSSQQRRSLTAHDVAKLPSPDEIASDLEEWLAS
GATMEDAPNEPGDGEPDDESGADGSDDRPADPDDDGPPAGRGGSTVWG
Download sequence
Identical sequences C7NIQ0
gi|256825493|ref|YP_003149453.1| 478801.Ksed_16730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]