SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258405390|ref|YP_003198132.1| from Desulfohalobium retbaense DSM 5692

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258405390|ref|YP_003198132.1|
Domain Number 1 Region: 122-221
Classification Level Classification E-value
Superfamily Multiheme cytochromes 2.17e-16
Family Cytochrome c3-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258405390|ref|YP_003198132.1|
Sequence length 224
Comment cytochrome c class III [Desulfohalobium retbaense DSM 5692]
Sequence
MKRLLPFWGFGCLAVFGLVLGTAITGLAVSEMDKLEDEMTIEALESVSFEELEAAENEAA
EAKKAEPKQAAETPEVEDDATEQAGAEEQETAAEESATKSEAPAETAAAEAPEEEASGGS
GVPPQMVTLDAAKGKAQGLYSPVDFDHELHLTTGACTDCHHMYEQTGTYQPCSNCHEPKV
DAASPKMSLFNAYHNRKNIASCVGCHTEMQVGPTGCRDCHTVGQ
Download sequence
Identical sequences C8X1Y2
485915.Dret_1266 gi|258405390|ref|YP_003198132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]