SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229604108|ref|YP_002866769.1| from Bacillus anthracis str. A0248

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229604108|ref|YP_002866769.1|
Domain Number 1 Region: 35-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-28
Family Beta-D-xylosidase C-terminal domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229604108|ref|YP_002866769.1|
Sequence length 198
Comment hypothetical protein BAA_2500 [Bacillus anthracis str. A0248]
Sequence
MKISHIPEHIEQLTIMNVPEYYKLNNNHALIVRSKAETDFWLKTHYGFQVMNGHVFYTET
MTDFQAEVQLRMNPNSKFDQAGLFVMISEKCWLKTSLEYIPDGPSHLGAVVTNNGYSDWS
TQDFPTELANEQLRFRIVRKRGDYTIYVKKIHQWEQIRIAHLMEDIGNKPIKIGFYTCSP
SKNNGFETEFLEFTTENI
Download sequence
Identical sequences A0A0K6N2B1 A0A150B0K2 A0A1Q4LZY2 D8GXX9 Q81QI3
gi|30262441|ref|NP_844818.1| gi|47778046|ref|YP_019083.2| gi|229604108|ref|YP_002866769.1| gi|301053953|ref|YP_003792164.1| gi|227814748|ref|YP_002814757.1| NP_844818.1.87267 WP_000703156.1.11387 WP_000703156.1.33536 198094.BA_2442 261594.GBAA2442 568206.BAMEG_2158 592021.BAA_2500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]