SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258513627|ref|YP_003189849.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258513627|ref|YP_003189849.1|
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.62e-45
Family N-utilization substance G protein NusG, N-terminal domain 0.0000283
Further Details:      
 
Domain Number 2 Region: 119-173
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.3e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258513627|ref|YP_003189849.1|
Sequence length 175
Comment NusG antitermination factor [Desulfotomaculum acetoxidans DSM 771]
Sequence
MDKQWYVVHTYSGYENKVKANLEKRIESMNMEDKIFRILVPMEDEVEIKNGKKKISKKKV
FPGYVLVEMIMTDDSWYVVRNTPGVTGFVGSGSKPIPLNDAEAAQIIKQMGLEEPRARYD
YNTGEIIRVISGPFEGFEGHIEELLLDKEKVRVMISMFGRETPVELDFTQIARLD
Download sequence
Identical sequences C8W3X2
485916.Dtox_0273 WP_015755947.1.30109 gi|258513627|ref|YP_003189849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]