SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258515197|ref|YP_003191419.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258515197|ref|YP_003191419.1|
Domain Number 1 Region: 26-371
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000177
Family Quinoprotein alcohol dehydrogenase-like 0.0091
Further Details:      
 
Domain Number 2 Region: 432-482
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000288
Family Type I dockerin domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258515197|ref|YP_003191419.1|
Sequence length 484
Comment Pyrrolo-quinoline quinone [Desulfotomaculum acetoxidans DSM 771]
Sequence
MIVKWGKNKFLVFFTVMLLFLLTANAAFAADWTKFQKDNVNSGVTTDNPPIDPNPNFVMT
DLPNAGWNGTDIPPLVVNEGGVYYAYVFNSTPSDARIYKINCSDGTTPTGWTDGIIVDSD
GGFQLGTPVISGTTLYLGVTEGNQNKLKKIENIASTPKVDTLIPISDSGQFNTPFVLDGN
NLYFGLWNPPGTGKYYKVDLSSNTVTTFTPSVSGEGFYWAGVAIINDYLVFGGDKSKVYV
VDKNTMSLLSSGSIKDIESNAAEIRSSICYNSSNSEIYFTDKGGFLWCYGIDNSGSLTYR
WHAGIGYSTSTPVYDNGKIYVGRGNFSDGKIYCYNENGSKLWEYSTDGGVQSSPVIYCKG
GNTYIYYTTNSASGKGYCLKDDGSSRTVVWIVPSSGGTYTVQGMAASGNYVVFGNDYGQI
FMIRSNSDSGYDLNSDGSVNVQDIILVGQHFGESGTPGWSNFDINRDGKVDVLDMIAIGQ
YFTL
Download sequence
Identical sequences C8VYB5
485916.Dtox_1960 WP_015757501.1.30109 gi|258515197|ref|YP_003191419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]