SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258515199|ref|YP_003191421.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258515199|ref|YP_003191421.1|
Domain Number 1 Region: 27-311
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.34e-41
Family Quinoprotein alcohol dehydrogenase-like 0.00088
Further Details:      
 
Domain Number 2 Region: 414-495
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 1.8e-18
Family Invasin/intimin cell-adhesion fragments 0.004
Further Details:      
 
Domain Number 3 Region: 504-554
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000422
Family Type I dockerin domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258515199|ref|YP_003191421.1|
Sequence length 556
Comment Ig domain-containing protein [Desulfotomaculum acetoxidans DSM 771]
Sequence
MLRVKMKLTGLLFFLIMVLILPAAGYAAGSDWPQFHNSANSAGYSTSAAPNTNNLLWASE
NIGASISSSPVIAGGKVYVYGCPSSDGFSASKSSIVCLDETTGDKIWETAIDKSKWGSWS
SPAYDNGKIFIGSGSKAFCLDATSGTILWSYPMHLDVVNGSPRVVDGKAFFTDWDPNHGG
ISYIYCLDANGGSRIWEHQLVGDSQSTPAYCDGKIYVNSWGYVTGANTGANNTYCLDAGD
GHEIWHQQGLEKQTCGSPSVGGGKVFVATYDFYGMGELAALDAGDGHIIWGPITIQRTDT
TPAYADGKLYLCGGCAGYSDQETYCFDAETGNQIWKQSDLGNWTCSVAVADNKVFVGKAG
EFFDYTGVYALDVADGHVVWSSDKGGASPVVADGKVFSLSGGIVYAFGSASASVSVTGVS
LDKTADTIPVGGTDTLTATIAPANASNQGITWASDNETVATVDAAGKVTAVSTGTANITV
TTTDGGFTAACLVTVTSGGGSGNDLNGDGIVNVVDLILIGQRFGDSDVPGWINLDVNRDG
KVDILDMVLVAQNFTS
Download sequence
Identical sequences C8VYB7
485916.Dtox_1962 gi|258515199|ref|YP_003191421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]