SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258515206|ref|YP_003191428.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258515206|ref|YP_003191428.1|
Domain Number 1 Region: 1093-1141
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000363
Family Type I dockerin domain 0.0046
Further Details:      
 
Weak hits

Sequence:  gi|258515206|ref|YP_003191428.1|
Domain Number - Region: 272-371
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000932
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258515206|ref|YP_003191428.1|
Sequence length 1143
Comment GLUG domain-containing protein [Desulfotomaculum acetoxidans DSM 771]
Sequence
MTFCDFSEAKGMGVKLRKTMLRKPLTIFMVLIMALALLPVMAPAEDGAGTPAMSSLALFT
DKSCVTPIQFDEPFSSGHFDYNANIPDYLSSVYAMGVASNSSDFLKFEMQRSGWGGTGIA
MANLPVLISNLNLYQTNANSTFTFRAGPQSNISADNGDVFYHVHFKRMPTLKSLSVNDTL
TPTFNRDVFSYTAGVDAEAASVDIAVTGYNKAYVITVNGQAPVDGTASVTLNWSADGTMQ
VPITVSGGTSETIYNLGLIRETKSDTPVIYINPLPAVYVFTETPSPLTVRAAAYADVSYQ
WYVNTEDSTEGGQKIDGAESASYIPELETVSSTKIYYYYCVATNNTTEDFAVSKTAAVTV
MPDPTPVITRENADGSPLPAQYYEYNVGDTPVGMKVETTSVAEGGYFFYTWNCRLISGSV
TTKSGPDEKNVCLPYMNSDGETTYFCTVTHVINGKAYTADSEDFIVRVYETSAKMPYISS
QPSGTSYQLGETQITDLEIGAMVIAGTMSNEISYQWYSSTDGETYAPIEGATGYTLTPSI
LDTAGVIYYKCTVTDNFTSLSGKTYTSSIDSAVAVIRFIGGFGQWNGSGKQDDPFLLEDV
QDIEELRELVNTGTSFADYYFKMNADITLPDGWVPVGSVKEGSANEGAGANINPFSANFD
GGGHTITIPAGGKPLFGYVRLATISNLQIYGTEIAGAALIDNYTIDYGPGGQYSDVPAYT
ADIKNVTLKSGSKTLGSGLVNGNGSGENNIYFTGCVVESGVTVGYDKSRSNVGSLISSLN
GNILNCVSYADVYGTNHVGGLVGEKGQSMGYCTVWDSAFHGTVTASGQFAGGIMGSGYLA
GSAPNSPCVSIQNCSVTGTVTASDYIGGVFGGEGGVSECWENGIGYIQNNYFSGTLTATS
GNAAHVGGVIGYMHSLDRYNIISNNYYMEGSGVDSGIGAVAAVDKSTGLYSRGDDPTGAD
ADKLTKSFTSGELTDGTLLSVLNAGINSSGNWTAGFDGKPVVGSTRHILMITVDGIQSNR
FSSNDINDIYTKNITVLYSDRSTQSVSANGATVEGFNTTSTGYKTVTVTLQNHTYIFRLQ
VTTATGATGSDLNSDGSVNVQDLILVGQHIGESGTPGWIDFDLNSDGTVDVLDMILVGQQ
FTA
Download sequence
Identical sequences C8VYC4
gi|258515206|ref|YP_003191428.1| 485916.Dtox_1969 WP_015757510.1.30109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]