SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258515209|ref|YP_003191431.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258515209|ref|YP_003191431.1|
Domain Number 1 Region: 1450-1498
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000795
Family Type I dockerin domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258515209|ref|YP_003191431.1|
Sequence length 1502
Comment hypothetical protein Dtox_1972 [Desulfotomaculum acetoxidans DSM 771]
Sequence
MVLNWKKAMYTALMLLAAFILALAMLPAQSAWTNQEAATDSVVTATYNDLDMVVPAEDEI
AKSSVAAATYSCSVEVQYPKTASRNGGLIDDNAGDAIEIYNSAGEPVPVTAPEDTQTGKK
IIFNAEPGKYKFKVYYTKDGVRTVGGEGTFEVVDVQGKQTFYLGYFNIKVGIDPETGKAP
GFNIVLRNSQGEIQNPGMVIGAEDGQGDIEHSYIVLACDGSNPYYWDATPVNDAFSPKDG
SFSWSRLNAVVLGSKKTERVAITRSIETTFQVTKGADLRVFRKGKAHFIPFTEYTPTYMG
TTGDEKYDIYKFNIPSGADGIHYEAGGGEWLKQCQCFTVNPGGTDLTITLDLAVLDNSHR
VDNGFIDDNLYMNLDDSKYVVLKKGESFDLFPIRVWQAQLGVVDNYFVEPDYHVEVMGGS
VSEQWTGKPGRELLKVTGKQTGISIIKISYDALGWLESPGNVISGSYSPPSGIKYYFNAI
DPINTGIVVVNVVDDADSGNAANIKTNIDQREYDTVYFDKNKSDSAPYTFKPTADSGTIS
VRVHDPLHNTGWGEGWTSCAANPDGSFTVNLKEGRSIIEVSAGDSVRYHVVNAKGLQVNI
VNKSNPDWKPGEPFNLGETASVSFEGLEIPIQKIAGIYNPGYPYTQYVQYETQDGRLCLG
PPTQYDITSYNTVSVLLSEPGEFLLHKGRIHCGHLGSALNAHRNISPSGVMPNFNASEGE
NNPLFSTLPDITFEVQDNEFASEQAKLEYAALKELFYNYYGPNYAPLEGINSSQLNITGI
DISNNNLSVYIYPKNNDVSVKARCWFQSNPGNVTETNMPIRDNGIASGILIGAVTGPDVG
YGELTLTPLDPEKGYPITYTFRLVFDEGIGKYPYITGIKINPVNGTQDMNFQHGKLRAVA
EEDLGYGFLSTRHEFTATVPYSTDKIIITASPLTEGEVTTAVTVNGEALGGSGISQEISL
NEGENTITVAGSVYSNETPVQYTLLVTREKAPNKVTFEGAEGGRLVIKSAGGKTMTANED
GSYYLPVGQGYIYYYGRNGYLTATGTFDVTESTTGITLPALTEHQQSDGKVTVSAVSLNS
VLRDKQEVSYKAGEATDLASAGYVEYNNGGYTVLHALIDAFNQGNTKIPFTCARGNLTPD
IAINGNTAEGAGWVCEVAGKELSGDKLASTLVKNGDRIVYYYNANFAGMQNAWFEETNVT
VTQGEDAELTLVGADVKNDGGGVAGISGAKILVNSQNTGLSTGAGGSVTLPGSLIDTPGQ
YIVTAVKENEDGNNTLVYNQAIIRVNKTASGGSGTTVKFRLIGDSLHGGGCDDHSQYLNW
IKTKNYSFSGSSVTVYQVFMRALEEAGLEQTGAENNYVSGIYAPAGYGGYLLREFDNGPN
SGWMYTVNGDHPNVGLKYCYVTNGDSIVWHYTDDYRLETSFEGNTPLYPNRWLEAEDVDP
PSAGGETDCDLNSDGSVDVLDMILVGQHIGESGDPGWCSLDLNQDGHVDLLDMVLIGQNF
TI
Download sequence
Identical sequences C8VYC7
gi|258515209|ref|YP_003191431.1| 485916.Dtox_1972 WP_015757513.1.30109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]