SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258515212|ref|YP_003191434.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258515212|ref|YP_003191434.1|
Domain Number 1 Region: 914-965
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000334
Family Type I dockerin domain 0.0024
Further Details:      
 
Domain Number 2 Region: 164-263
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000204
Family I set domains 0.056
Further Details:      
 
Weak hits

Sequence:  gi|258515212|ref|YP_003191434.1|
Domain Number - Region: 587-706
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000667
Family Terpene synthases 0.074
Further Details:      
 
Domain Number - Region: 877-908
Classification Level Classification E-value
Superfamily PKD domain 0.000922
Family PKD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258515212|ref|YP_003191434.1|
Sequence length 967
Comment hypothetical protein Dtox_1975 [Desulfotomaculum acetoxidans DSM 771]
Sequence
MLKYHQRGLFFALFCALLFVFATGGTALATEVEEVNGLYVIATLPGSDTPLPVKYYGDIA
GSVAASPCYITVPAGTTQITIKKDPNLNTDYTFTSLRVYKPPYKAADKYPLDAGAEFSVT
VPATATRQNPYRINSAIKNSNGADTSNTIFFYCVEENGPNPFVTPDRQEVAEGSTVSLNV
YGTGNPAQPVEWYYGYYDSNSSTRIYEKLEGETGADLNITAVQDSLNLGSFNEETSQYSL
RFYTKIGTYISNEVYVTVNGTPVSKPDIKSLDASHWGSYAGAKLWLNVGAAFNDTVAAET
PVKFYLTAAENGTPDTAIAGTLVESTVAAVPGAAAEDYKDLGFLVQDLPAGSYWLAIQLG
TDNPSYSYRAFTVYPGVKEYVKASLDKMISWYQTKIFVKDGIYVGLSERRDGTDWDAWIF
PNYGYAVTDPLLAGADGKTYLDGLEAALKSRDAGGTLNSPKDDFRYVAALCAVGADPRNF
NGRNLVAELIGHAYNADGTLKLGKDGVLDLKIDILTVSYLLLGAEIAGATEAEGYTDALK
KAGIKAILPTVEMSVDERSDISMISSSDWLAMQSYPLYFLQDDLEYGDRIRDAVGKMAAM
VSTHLYANGGVTMNWPGVSSPGSFDTPLPATAYAVNPNSMAVMLNALVLFGATAEDLGSN
AWQEDWGTYMTALLSLQMDDGSVGFNGGSNDMATYQTLGALVELHTGRSCFVNARDTYLS
KYPDYAAQITAPFISDGSGARLSAGEGKVTFTSNEGGQAYYAVVDRGAAAPVIDTSGAGT
DCVSGVNTIVIGDLVDSSAKDVYLLVKDGDGHSSKTLQISMADSSADTGAPVITLNGASA
ITLNLGESFTDPGATATDNVDEDLTDRITVGGDTVDVNTPGTYTITYNVSDAAGNSAAQV
TRTVTVQGTETGDGDVNRDGKVNVMDMILVGQHFNESGAAGWISADTNKDGKIDVSDLIF
IGQHWKD
Download sequence
Identical sequences C8VYD0
WP_015757516.1.30109 gi|258515212|ref|YP_003191434.1| 485916.Dtox_1975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]