SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258515214|ref|YP_003191436.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258515214|ref|YP_003191436.1|
Domain Number 1 Region: 822-873
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000147
Family Type I dockerin domain 0.0028
Further Details:      
 
Weak hits

Sequence:  gi|258515214|ref|YP_003191436.1|
Domain Number - Region: 502-697
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00102
Family Protein prenyltransferases 0.094
Further Details:      
 
Domain Number - Region: 152-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00167
Family I set domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258515214|ref|YP_003191436.1|
Sequence length 875
Comment hypothetical protein Dtox_1977 [Desulfotomaculum acetoxidans DSM 771]
Sequence
MFRNHRRGLFFALLCALLFVFAAGGTAVAAQAPSLYAIATVPGSDTPLPIEYYGDNAGTD
VNPYYITVPAETDQITIKADPNKKVNYKYLHVNEDGNEFAPDAGAEFSVTVPTAATRSKP
YGVSVSYKSSSGSPGSKSFKFYCVEENGPNPFVTPASQELAEGSTVSLNVYGTGNPAQPV
EWYYGYYSDSSFSTRVYEKLEGENGTDLNIDAARDSLNLGYFDEAYAKYYLKFYAKIGTY
ISNEVYVTVNGTPVSKPDIKSLDASHWGSYAGAKLWLNVGAAFNDTVAAETPVKFYLTAA
ENGTPDTAIAGTLVESTVAAVPGAAAEDYKDLGFLVQDLPAGSYWLAIQLGTDNPSYSYR
AFTVYPGVKEYVKASLDKMISWYQTKKFIKNGIYMGLSDYRDGTDWDAWIFPNYGYAVTD
PLLAGADGKTYLDGLETALKSRAASGMLNSPKDDFRYVAALCAVGADPRNFNGRNLVAEL
IGHAYNTDGTLKLGKDGVLDIKPDILATSYFLLGAEIAGATEAEGYTDALKKAGIKAILP
TVEMSVDEGSDISMIASSDWLAMQSYPLYFLQDDPEYGDRIRDAVGKMAAMVSTHLYANG
GVTMSWPGVSSPGSFDTPLPATAYAVNPDSMAVMLNSLVIFGATAEDLGSNAWQEDWGTY
MTALLSLQMDDGSVGFNGGSNDMATYQTLGALVELHTGRSCFVNARDTYLSKYPDYAAQI
TAPFISDGSGARLSAGKGKVTFTSNEGGQAYYDVVDRGAAAPVIDTSGAGTDCAAGVNTI
VIGDLADSSAKDVYLLVKDGDGHSSKTLQISMEDSSADTGDGDVNLDGKVNVMDMILVGQ
HFNESGAAGWIGADTNKDGEIDVSDLIFIGQHWKD
Download sequence
Identical sequences C8VYD2
WP_015757518.1.30109 485916.Dtox_1977 gi|258515214|ref|YP_003191436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]