SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258515217|ref|YP_003191439.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258515217|ref|YP_003191439.1|
Domain Number 1 Region: 1022-1258
Classification Level Classification E-value
Superfamily L domain-like 2.21e-20
Family Internalin LRR domain 0.06
Further Details:      
 
Domain Number 2 Region: 1488-1686
Classification Level Classification E-value
Superfamily L domain-like 2.65e-18
Family Internalin LRR domain 0.063
Further Details:      
 
Domain Number 3 Region: 1988-2079,2147-2216
Classification Level Classification E-value
Superfamily L domain-like 1.05e-16
Family Ngr ectodomain-like 0.033
Further Details:      
 
Domain Number 4 Region: 2283-2331
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000392
Family Invasin/intimin cell-adhesion fragments 0.0073
Further Details:      
 
Domain Number 5 Region: 1287-1342
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000432
Family Invasin/intimin cell-adhesion fragments 0.015
Further Details:      
 
Domain Number 6 Region: 1712-1778
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000353
Family Invasin/intimin cell-adhesion fragments 0.016
Further Details:      
 
Domain Number 7 Region: 2340-2390
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000196
Family Type I dockerin domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258515217|ref|YP_003191439.1|
Sequence length 2392
Comment Ig domain-containing protein [Desulfotomaculum acetoxidans DSM 771]
Sequence
MKILKKSKIINILLVLLMLFTIVNPALAAGLTINPDQPAYSGGENAAVAASVYDDGTNAA
GGTDGSSAAESEDNREIAEDNESAGVTEPQNNSDQTVSNLVYPANDTEKQAASPAIVLNE
VSPDLGTVKVRVMDNVQRLAGDMPNISPAYREPFGEILPWTEVKITGGLTIRGALEKALA
AKGITAYGAESYLSGIGPVISEDGSRTVDKLSEFSSGNKSGWMVTLNDWFINAGANTFMV
KDGDIIEWCYTCDLGADLGADFNNNDTALKALSADKGIFTPVFAPQVKEYTLTLPAETQI
KVAPTAANRYNQVTIQSNNATYRSTDEIAVVDNQVISVTCGKNIYRITVVISNNDQSNAN
AVIDLIGALPAVDDIDLSDREQIEAIRTAYENLTDTQKALVANYSVLIEAESKIAQIDGD
NKTAADHVIALITALPAVNAITLADKEQVAAARTAYNSLREEQKALVDNLDALTAAEAKI
ASLENTGGSVVQNYPDDFLLSALNLEMEKGERKELVVLDTPRVGLDDQAFNRDDLIFSVN
NLSVAGAVYDDVVAVEKENSDGSKKGTRYYVKGLNEGVAQIKVTYPGYRGQDTVVAVNVK
KLSAAGPELTTDIALTKYDILYFIGDSLDYTFNVSTDSDASVAASVYGQEYAAQAGKITV
RLKDGYNPIVVTAGNAGGTTTKVFNIRAKKMAIQMENLTRTGSADMYEGDIIQISYSGLV
TPVPKVSRIYNPAAVGVSHSCKMPRYSIVSGSFSQYDLATSNGIRMELTGAGEFMLTDGH
IDENWFGDGLYSEAPVGTAPPVTGAGQTDHRFSVLPDIRLTVKENAEYNPQLFTVNLENT
EGIWPGDEVKINIPDLDIQTLAANHPKADEEWMTQEIINSYTAFNTNIPGLNTVKSESVK
IIEDLEKLKTVKFIVPKDTRPGIYNLTGGYVWVKYGPAWWTKQKNYFITEIPDISIEVKE
GVPGAEHGTIVISNTALKNKLAMAAGKGSGYTGNLTRNDLEAITGAVDLSHTDISDQDMS
LLQYLKGVSSIDLSGNTGITAATVRESTFDWTVPKSLNFSGCGGVTAITTAAFYECANLT
AITLPEGIASIGDRAFYSCKALTSITLPDTVTALGSNSFSRCTGLTGIVLSKSLQSIGEE
SFQGCTALAGIVLPDPVTTLKQQTFYDCRGLASITLPKNLQSIGEKCFMNCGALENITLP
DSVTTLGDFSLAFCRGLTGIELPKGIQKMGVGCFAGTSLAILDLRGTTFTNVDNNWQCPG
YTIVLLGQAAQLSPLAGVLLPGGSTLTITHDIPQDKAVVWSSSNTSVAIVAGGVVSGVNP
GKAYIGARADDNTYSGYCQVTVADAENVKLDELSLSGITLKENFDPAKYTYTAKITGEIT
STAVTVKAAVEGLVLTVNNKQVADGTPSEPVPLQVGNNSIEIKVTSADGMIVKTYTITIT
MAAISVVDDGIVFGNPLLREKMAVAAGKESGYTGKLTLAELAAITGTVDLSNAGITNDDM
AVMKYLTGVSVINLSGNTAITSSAFKKDYFDWKTPKSLDFSGCTGITGMNSQAFRNCANL
TGIAMPETLTSISSYAFENCIKLTVVSIPRSVGSIGSNAFYGCVSLTDISLPDSLTKMDA
NCLSQTGLKEIPVLPSGVTALPGRCFYGCSKLTYAKVSGYVTQIGASCFDVCPALAILDL
RATSFSSVDANWKVPSSTICLLPGSDAGLLPETSTIKLGEETLTISHSIPPDKTVIWGSS
DTGVAVVANGVVTGVEPGDAIICAKTDDNSYSGICHVSIVDTDNAKLQSLSLSGIVLNEA
FNPSRNFYTAETGCHLKETAVTALAAEAVSGITVNDLPAAEGIPSEPVALSLGDNIIRVK
VTTPDGTVTKTYTVSITVKTVYEGDGFVAIDNRELKNRLALAAGKESGYSGNLTFADLAG
ITGSIDLSNAGVTDEYMTVMKYLKGVSLIKLSGNSAITAATAQASSFDWTVPKSLDFSGC
TGIKEIVQNAFKDCSNLTGIILPETVASLGNNSFYNCSGLTAMVIPEGVTSIGGGCFRGC
GGLSSITLPAGIKSLGNGAFNSCIGLTSADLSAVDGNVLSSSLFQACTGITDLSNIKLPP
GIEHLPDSFFYGCTGITVIKLPESINSLGNSAFSGTGVIEADLSAINTLGSSLLQNCPNL
KTVKLAQGITGLPDNFLNGCTALSSIDLPDSLTSIGYNCFQNTKLTYIAVSANVTSLGNN
CFNGVGTLAILNLRATNFTSVNSNWKVPAAAFVLLPGADAQLSPGSGKIEPGAALTISHG
IPPEKTIAWCSSNPAVATVAGGVVTAVAKGSAVIAAKAGDDSYSGVCTVTVGEAVAGICD
LNSDGSVNVQDMILAGQHFGESGTPGWSEFDINRDGIVDVLDMILVGQHFTV
Download sequence
Identical sequences C8VYD5
485916.Dtox_1981 gi|258515217|ref|YP_003191439.1| WP_015757521.1.30109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]