SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258515224|ref|YP_003191446.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258515224|ref|YP_003191446.1|
Domain Number 1 Region: 1170-1511
Classification Level Classification E-value
Superfamily L domain-like 5.44e-25
Family Internalin LRR domain 0.028
Further Details:      
 
Domain Number 2 Region: 209-440
Classification Level Classification E-value
Superfamily L domain-like 9.35e-24
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 3 Region: 673-895
Classification Level Classification E-value
Superfamily L domain-like 1.09e-18
Family Ngr ectodomain-like 0.035
Further Details:      
 
Domain Number 4 Region: 478-527
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000282
Family Invasin/intimin cell-adhesion fragments 0.012
Further Details:      
 
Domain Number 5 Region: 929-985
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000769
Family Invasin/intimin cell-adhesion fragments 0.013
Further Details:      
 
Domain Number 6 Region: 1556-1606
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000824
Family Invasin/intimin cell-adhesion fragments 0.0061
Further Details:      
 
Domain Number 7 Region: 1682-1729
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000186
Family Type I dockerin domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258515224|ref|YP_003191446.1|
Sequence length 1732
Comment Ig domain-containing protein [Desulfotomaculum acetoxidans DSM 771]
Sequence
MPDIRFTVKENAEYQPQLLAVNVENTEEIWPGDEVNITVPDLDIATLVVNHTTIDQSNIV
DLLDSYTSFVTDIPGLDTVKSENVKAIGDLEKLKTIRFVVPENTIPGTYTIKGGYVWVKY
GPTWWMKQKNYFTTKISDITIEVKEPDTDGQHGSVVINNAVLKNRLALTAGKEDGYEKDL
TVRDLEAITGAVNLSDAGITDGDMAVMQYLKGVSSVNLSGNTDITTATVKKVTFDWTTAK
SLDFSGCTGVTEIAAQAFEECNNLTAIILPEGTASIGDKCFRSCKELIYVSLPDTVTSIG
AQSFIGCTKLASIRLSKNLQSIGDESFEGCYALKDIALPDSMTALGKGIFYGVIYLESIK
LPENLQSIGQDCFRGCNSLSDIILPDTLTTLGANSLSFCYKLRYLKLPNSLQSIGDGCFS
GDSLAILDFRQTNFTNVDTKWGIPTSAIVLLGTDAQFSPLTGSVKLGEETLAINHIIPPD
KTVIWGSSDNTVATVENGVVTGVQAGTAFIYATTADNTYSGCCQVTVTDSGGVVLQELSL
SGITLNETFDPTKYIYTAEIAGDVRSTTVIARAADTGSILTINNEVVEDGTPSGAIALKA
GVNTIQIKVASADGTVIKNYTVNITMKAVSIGDGYVAVGNSVLQEKLAVAAGKESGYTGK
LTFVELAAVTGSIDLSNAGITNDDMAVMKYLQGVSAINLSGNTAITSATVKKDTFDWRTP
KSLDFSGCTGITSIGTNFRECSNLTGIMLPNTVKKVDNYAFYMCTGLVDIGLPEGITSIG
DSAFVGCSALIQIDLPDSVTGLGGNCFALAGFQEIPVLPSGITALPNGCFAECAKLTCAA
IPDHVISIGSNCFNKCTALNYVVFQNNGIAIASNCFNNCTSLAILDLRKTNFTSVNAAWK
VPGTTAVLFPGLDAGLPESANIKLGEETVTIAHSIPQDKNVVWVSSDTGIATVSNGVVAG
TKSGTAIICAKTDDNSYSGICRVTVADTDNARLQELVLSGITLKEAFDPSVIFYTAETGC
HLTGTTVNVRAADAGSAIKINNQMLTDGVSSAFIPLALGANTILVKVTTPDGTVTKTYTI
TVTMKVVFEGDGFVAINNSAFKSKLAIAAGKESGYSGNLTLTELAAITGTIDLSNASINN
EDMAVMKYLKSVSAINLSGNTVITSAVVNGSIFDWTVPKSLNFSNCTGINGITANAFKDC
SKLTGIVLPDTVASLGDNSFYGCKALTGINIPEGVNVIGRACFSACTGLTSITLPSSVNS
LGNSVFLGCTGLTEADFSGIATTTLSPNIFQGCTGITDLTKIKLPQGITGLPDYFFSGCT
GIKKIELPDSINSLGNGVFQECTSITEIDLTGMSVLGLSLLQNCINLKTVKLPQGMTSLP
ASFFKDCTGLNSIELPDSITSMDNSCFYGCTGLSSVVLPDSIISMDSSCFYGCTRLSSVV
LPDSITSIGNSCFYGCIGLSSIELPESITSLGKNCFQNAGLTYLDVPSSVTSIGSSCFNI
VTLTVLNLRTTGFTSVDAGWKVPAAATVLLPGADAGLSSGSGIIKPGDTLTLTHGIPSGK
TVVWVSSNPAVATVAEGVVTGMAKGTAVIAVKAGDDSYSGVCRITVADSAADPVAAVIEM
IEALPASDNITLADKVSVEAARTAYNALTEAQQGMVVNLAKLTESETRIAQLMEDETDCD
LNSDGSVDVLDMILVGQHIGESGTPGWCSFDINQDGQVNLLDMVLAGQNFTI
Download sequence
Identical sequences C8VYE2
485916.Dtox_1988 gi|258515224|ref|YP_003191446.1| WP_015757528.1.30109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]