SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557693757|ref|YP_008796811.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557693757|ref|YP_008796811.1|
Domain Number 1 Region: 7-131
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.17e-33
Family Translational machinery components 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557693757|ref|YP_008796811.1|
Sequence length 131
Comment small subunit ribosomal protein S9 [Candidatus Caldiarchaeum subterraneum]
Sequence
MRKAEQIFVGKRKTSVAKVFLRPGKGNIFVNKTPLELFNEFFRSKVLTPLLLLPEFWKKH
DFHVTVKGGGVMSSAEAIAIAVSKAAAAESEEYKQRLESYDRSLLVDDPRRAEPKKPNRR
GARRKPQKSYR
Download sequence
Identical sequences E6N507
gi|557693757|ref|YP_008796811.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]