SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557694002|ref|YP_008797056.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694002|ref|YP_008797056.1|
Domain Number 1 Region: 14-220,325-417
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.19e-36
Family Bacterial dinuclear zinc exopeptidases 0.0031
Further Details:      
 
Domain Number 2 Region: 208-319
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000000284
Family Bacterial exopeptidase dimerisation domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557694002|ref|YP_008797056.1|
Sequence length 429
Comment conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MTATIQDVLAKIDVEKTIKRTLDLANIESPTGFEGECAEAYARMMEEVGMRVKLQEVEPG
RLNAVGVLPGKGGGPSLMFNGHLDTSFSPREPAEILKAISPVYRLEPPWAYREGDWLYGM
GVFNMKGALAAYVSAVEALQNAGVELKGDIMIAGVVGEIEKTQVDQYRGAQYRGYGTGTA
YLVTHGGVTDFAILGEPTGLRLMLTHFGSVWAKMYLKGQMVHTAHSTGVTNLILRMNRVL
NVLEEWIPKYQERFSHQGVKPTVNIGSIEGGWPWRCSRTPWFCNLYVDLRYPPPYSAVDV
KEALEEMLNEVEKRYGFKPMLDIYVSDAWATVPEDSAVVKAIDEGHKAVFGTPAERVVFS
WSSDANVLTRNGVVAVNYGPSGGPGKEMRGTLYIPNLIACTKVYTVASMNLCNMDRKKVK
QRFTITYGE
Download sequence
Identical sequences E6N5R0
gi|557694002|ref|YP_008797056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]