SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557694017|ref|YP_008797071.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694017|ref|YP_008797071.1|
Domain Number 1 Region: 14-95
Classification Level Classification E-value
Superfamily MTH889-like 3.53e-28
Family MTH889-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557694017|ref|YP_008797071.1|
Sequence length 100
Comment conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MNTRKMPDKHELVLTRLVLDVLKPHKPGMVEFAQALTGLRGVTKVEVSIIEVDADTETVK
LTVEGNNINFEQIANTVKQLGAAVHSVDQVTYSHPTKQQT
Download sequence
Identical sequences E6NAL6
gi|557694017|ref|YP_008797071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]