SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557694127|ref|YP_008797181.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694127|ref|YP_008797181.1|
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily SirA-like 3.01e-22
Family SirA-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557694127|ref|YP_008797181.1|
Sequence length 82
Comment conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MVFAKPVLTVDVRGAMCPWPVLKTREAVQRINVGEVIEVLATDPASKPDLEAWARKTGNR
ILSVEESGSDPVVYRFLIERVK
Download sequence
Identical sequences E6N2T0
gi|557694127|ref|YP_008797181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]