SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557694238|ref|YP_008797292.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694238|ref|YP_008797292.1|
Domain Number 1 Region: 2-73,146-328
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 2.4e-68
Family Pyruvate kinase 0.0000521
Further Details:      
 
Domain Number 2 Region: 335-440
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.08e-21
Family Pyruvate kinase, C-terminal domain 0.0068
Further Details:      
 
Domain Number 3 Region: 69-155
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.00000000000541
Family Pyruvate kinase beta-barrel domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557694238|ref|YP_008797292.1|
Sequence length 453
Comment pyruvate kinase [Candidatus Caldiarchaeum subterraneum]
Sequence
MRTKIACTLGPSLQEVVDIEKAISLGCRIYRINFSHGNPILWRQLADNAREAAEKRGEKI
VLIGDLRGPSIRVSGLETSISLRAGERAKFSLDGPLSLPYPRFFETVEVGDTLLLDDGRG
MLKVVAKDETSIAAEAIRPATISPNKSIVIRGKEVQVPDYLATCREQLQAAADMELDYVG
LSFVTKAADVDAAKTFLHEKGLATGVIAKIETPSGVKNVDEISERSDAVLIARGDLGMHF
PLEYVPRLQKTIIDAAYNACKPVIVATQLLGTMVNEPVPTRSEIVDVMTCVEDGVDVLML
TAETAVGRYPLESIQWLVNIAETYEKGIEPRRALPPSAEVVDRFALAVVNLAESLAAKIA
IFTINGNMARRIARFKPVSGIIAATPNHDVVPRLMLLWGVTPLLLEAQSYAEGLEKLEKK
LEEERLAEPGDTYVLTYGLVKEPIHIVKMKKFM
Download sequence
Identical sequences E6N6B7
gi|557694238|ref|YP_008797292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]