SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557694449|ref|YP_008797503.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694449|ref|YP_008797503.1|
Domain Number 1 Region: 105-275
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.67e-35
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.025
Further Details:      
 
Domain Number 2 Region: 19-110
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.38e-19
Family Ferredoxin reductase FAD-binding domain-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557694449|ref|YP_008797503.1|
Sequence length 284
Comment oxidoreductase FAD/NAD(P)-binding subunit [Candidatus Caldiarchaeum subterraneum]
Sequence
MIAEQKIQPEEGLDTFAIKWCRVVSRRRETPDTYTLKIKPLNGSVNYSPGQFSMLYRYGV
GEAPISFSGDSDNGEQVEHTLRAVGGVTRALASAQPGDTVGMRGPFGNGWPLKEAEGHDV
VVVAGGIGLAPLRPLIRHFLRSREKIGKLYILYGARSPGELVYKRELQAWKKRLGARLLI
TVDKGDEKWRGHIGVVTTLFKYVTLDPENTYAYICGPEIMMRFTIAELKKQGLGDDRIFI
SMERNMKCGVGLCGHCQFGPYFVCKDGPVFSYSEVSHLFGRREI
Download sequence
Identical sequences E6N714
gi|557694449|ref|YP_008797503.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]