SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557694476|ref|YP_008797530.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694476|ref|YP_008797530.1|
Domain Number 1 Region: 3-164,285-365
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.33e-52
Family Bacterial dinuclear zinc exopeptidases 0.0019
Further Details:      
 
Domain Number 2 Region: 166-281
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000000133
Family Bacterial exopeptidase dimerisation domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557694476|ref|YP_008797530.1|
Sequence length 373
Comment conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MDSDRVLELLERLVAVPSLSGHEEKVCDLVAEHVESLGFVVERQEVYKTGYNVVTKLGDG
CDVLFCGHLDVVPEYDMADAFRPRVVGDKLYGRGACDMKGGVVSLLLLLESLRQMEPEPN
VSFAFVVDEEMYGRGAAELLRRGMRAEMCVITEPTSGVICVGNASCMEFRLTASGKSGHG
ASRAGGNAVKSLMGFYEVFERGLMKELDVRGSDFPMSPIINLGKFEGGYGGWVIPSKAYC
EVLVHMHPSISYRDGLDTVRRLVEEIAEELGIVVELTMLHGCDGYILPQTNQHLHKLKQA
YSMETGQKPKTGLIESETDGNALYHKGGIPCIVYGPGDITYAHSSQEHVSIKDVIECYRV
LRRFINMVSGLRK
Download sequence
Identical sequences E6N765
gi|557694476|ref|YP_008797530.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]