SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557694906|ref|YP_008797960.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694906|ref|YP_008797960.1|
Domain Number 1 Region: 15-203
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000017
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.025
Further Details:      
 
Weak hits

Sequence:  gi|557694906|ref|YP_008797960.1|
Domain Number - Region: 215-278
Classification Level Classification E-value
Superfamily Prefoldin 0.0314
Family Prefoldin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557694906|ref|YP_008797960.1|
Sequence length 284
Comment hypothetical protein CSUB_C1479 [Candidatus Caldiarchaeum subterraneum]
Sequence
MQTPNSAMGLLPRKSDSIADLRKEVAAIRVQVIEKLEERISLLEEALAKLKEDVRQVLEQ
VSSPQRTLSSLQSVVEKAYLLDQALDSYRGLTEEVKSLSESLHETADLLSNQRAELVKEV
QRLMQERESLSRLREEVLKWREELESKEKQIAEAQETLKQLITKKEALETEINILSERYL
TSFEEAQKKLENFGREMDKLFKLREIRMERMIRRERELEERLAALEKSKAEAETLIETSN
KLREEVKKLEAYKETLAREIAEMERRRTELNELITEMRRAFLTS
Download sequence
Identical sequences E6N8K0
gi|557694906|ref|YP_008797960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]