SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557694998|ref|YP_008798052.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694998|ref|YP_008798052.1|
Domain Number 1 Region: 9-237
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.47e-66
Family G proteins 0.00000326
Further Details:      
 
Domain Number 2 Region: 461-620
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.33e-45
Family Translational machinery components 0.0000396
Further Details:      
 
Domain Number 3 Region: 258-377
Classification Level Classification E-value
Superfamily Translation proteins 4.71e-29
Family Elongation factors 0.0018
Further Details:      
 
Domain Number 4 Region: 621-714
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.35e-20
Family EF-G/eEF-2 domains III and V 0.0021
Further Details:      
 
Domain Number 5 Region: 386-461
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.26e-17
Family EF-G/eEF-2 domains III and V 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557694998|ref|YP_008798052.1|
Sequence length 728
Comment elongation factor EF-2 [Candidatus Caldiarchaeum subterraneum]
Sequence
MPRVKRISEVVDILRNKESIRNIGIIAHVDHGKTTTSDSLLAAAGLLSPSLAGRALALDY
LEEEQQRQMTIKAANVSLYYEMDGKPYIINLIDTPGHVDFSGRVTRALRAIDGAIVVVDA
VEGVMTQTETVIRQALGERVRPVLYINKIDRLVKELKLPPEKIQETLARIVREVNTLIDM
YGEPEQREKWKISFADNTVAIGSSKDRWGFTVKQAQQKGIKFSDVIDAFSREDVEWLRQK
TPLHEALLEMVISKHPPPHVAQKYRISKIWKGDLESEVGRAMLDCDENGPTVMAVTDVRV
DPQAGVVATGRLFSGTISEGDSVIIVGRNISGRVQQVGVYMGPSREIVGSIPAGNIPAVL
GLADVRAGDTIGTVETVPFESLKYVSEPVVTISVEPKYSRDLPKLVEFLNKLTIEDPTLV
TVVRPETGEYLISGMGTLHLEIALTWIQKAGLEVVSGRPIILYRESVQSKGREFEGKSPN
RHNRIYTRVEPLEPEIIELIRKGELFDEMDRKQVAKILREHGWDADEARNVWTIDGRGNI
LVDATKGAQYLQESKMMILGGFQRVMQEGPLAAENMRGVKAVLTQVELHEDPVHRGYAQI
APATWRSLYASVLSASPVLLEPVLKIEAKVSQEFMGAVTSTITSKRGRVLDVKQAEYVTV
VVGEIPASETFDLSEAMRSATMGKAFWATEFSEWKPVPASLRDKVIQEIRKRKGLPLEIP
TIEQFVEE
Download sequence
Identical sequences E6N8Y0
gi|557694998|ref|YP_008798052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]