SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557695005|ref|YP_008798059.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557695005|ref|YP_008798059.1|
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.56e-47
Family Ribonuclease PH domain 1-like 0.0000054
Further Details:      
 
Domain Number 2 Region: 153-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-22
Family Ribonuclease PH domain 2-like 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557695005|ref|YP_008798059.1|
Sequence length 246
Comment exosome complex component RRP41 [Candidatus Caldiarchaeum subterraneum]
Sequence
MEEVMKIRLIDENGLRVDGRRPDEMRKMRMEVGVLEKTDGSAYVELGGTRIYAGVIGPRE
VHPKHLELPDKGVINCRYHMASFSVDERKPLGMTRREIELSKVIREALETVVFLEEFPRM
MIDIFVEVIQADGGTRTAGITAASLALADAGIPMADMIAAIAVGKVDGVLVLDINEQEDK
YGEADMPVAIAPHLNSIVLLQLNGRMTPEEVDKGLEMAQQAVQKIHHMQIEALKRKYRVE
PEGLET
Download sequence
Identical sequences E6N8Y7
gi|557695005|ref|YP_008798059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]