SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557695056|ref|YP_008798110.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557695056|ref|YP_008798110.1|
Domain Number 1 Region: 190-307
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.37e-21
Family Mevalonate 5-diphosphate decarboxylase 0.023
Further Details:      
 
Domain Number 2 Region: 1-167
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.19e-21
Family GHMP Kinase, N-terminal domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557695056|ref|YP_008798110.1|
Sequence length 320
Comment diphosphomevalonate decarboxylase [Candidatus Caldiarchaeum subterraneum]
Sequence
MKAKAVAHPMEGLVKYHGLKDWRLRIPYHDSISVNLKAFNTVTEVEFGDFEDSAMVDGVA
LEGRELERVKAVIDHVRKLAGIEAGFRMVSRNSMPKGSVKGLGFSSSAGAALAAAAYRAA
GLDKMYGWDYRLVSRIARRLAGSACRSVVGWYARWFTGFSDETSYAVSFADEKDLDIRIV
VVPLSLGFRTEDAHREAELSAFFEARVKAAQKRCDMLEQVIKDGDFTGFGQLVELDALEL
HGVTSTGPSRMILATKDSMRIVELVQDMRRENVECYFSMQTGPTVFINCLPEDSEYVATR
VADAGYRCVVSEIGGPVKTE
Download sequence
Identical sequences E6N976
gi|557695056|ref|YP_008798110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]