SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557694348|ref|YP_008797402.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694348|ref|YP_008797402.1|
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000027
Family RecA protein-like (ATPase-domain) 0.081
Further Details:      
 
Domain Number 2 Region: 225-293
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000834
Family ATP-dependent protease Lon (La), catalytic domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557694348|ref|YP_008797402.1|
Sequence length 377
Comment DNA repair protein RadA/Sms [Candidatus Caldiarchaeum subterraneum]
Sequence
MYLTSEQSPSDLKSIIQRLYNEGISEPLSENLLIEPLPDLRELEIWSRIILGEKRVAEYS
GIKLVVIDSVQAGGVSPAARKMYTRVNKFTTALKNRKITTFLTSHVTKKGDIAGPKDLEH
HVDCVLQFRRAFKLRPLFVPKNRFGPAKLDPFVLEIGNNGLYPSRHAEGIVGKANGISFA
TGAFAEIQARVEIPKWGEHGGVRAPYLPRQRIEQLIDTIRNIPNIDVSNLTYNIDCLMRS
SPHKQYDHGFDLAVVIALLSSYVQKGINEGCCFYGEVDLQGAVRSASAFKEAAHLKEILE
IDEEEDDEAVQLRGFYPVPNILSDTLTTELKKFDTLYVPEEIAKDMASLLDLFGFDVKCK
GVSSVYNLIQELWPEIL
Download sequence
Identical sequences E6N6M7
gi|557694348|ref|YP_008797402.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]