SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|472333236|ref|YP_007665511.1| from Mannheimia haemolytica USDA-ARS-USMARC-183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472333236|ref|YP_007665511.1|
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.43e-34
Family Thioltransferase 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|472333236|ref|YP_007665511.1|
Sequence length 108
Comment Glutaredoxin-4 [Mannheimia haemolytica USDA-ARS-USMARC-183]
Sequence
METIDKIKQQISENPILLYMKGSPKFPSCGFSARAVEAVINCQVPFGYVDILTNPDIRAE
LPKFANWPTFPQLWVEGELVGGCDIVLEMLQKGELQTLLKETAAKHAA
Download sequence
Identical sequences A0A0B5BU55 A0A248ZXV0 E2P9D3 M9X1E4
gi|526469308|ref|YP_008339537.1| gi|525656355|ref|YP_008219740.1| gi|472337121|ref|YP_007669395.1| gi|482887350|ref|YP_007884523.1| gi|525663356|ref|YP_008222320.1| gi|525702039|ref|YP_008233757.1| WP_006247956.1.100578 WP_006247956.1.101281 WP_006247956.1.14651 WP_006247956.1.15850 WP_006247956.1.18032 WP_006247956.1.20456 WP_006247956.1.2132 WP_006247956.1.21690 WP_006247956.1.22107 WP_006247956.1.23336 WP_006247956.1.24300 WP_006247956.1.25136 WP_006247956.1.26880 WP_006247956.1.27302 WP_006247956.1.2785 WP_006247956.1.28573 WP_006247956.1.29735 WP_006247956.1.30596 WP_006247956.1.33793 WP_006247956.1.34159 WP_006247956.1.40079 WP_006247956.1.41844 WP_006247956.1.42410 WP_006247956.1.42606 WP_006247956.1.43708 WP_006247956.1.44810 WP_006247956.1.45083 WP_006247956.1.47009 WP_006247956.1.49314 WP_006247956.1.49495 WP_006247956.1.50719 WP_006247956.1.52776 WP_006247956.1.55804 WP_006247956.1.61638 WP_006247956.1.62250 WP_006247956.1.63192 WP_006247956.1.63974 WP_006247956.1.72771 WP_006247956.1.73398 WP_006247956.1.73782 WP_006247956.1.73864 WP_006247956.1.74727 WP_006247956.1.74925 WP_006247956.1.76946 WP_006247956.1.78880 WP_006247956.1.8019 WP_006247956.1.802 WP_006247956.1.81289 WP_006247956.1.82341 WP_006247956.1.84529 WP_006247956.1.8479 WP_006247956.1.90102 WP_006247956.1.91740 WP_006247956.1.93146 WP_006247956.1.94296 WP_006247956.1.95684 WP_006247956.1.95739 WP_006247956.1.9701 gi|472333236|ref|YP_007665511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]