SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226305205|ref|YP_002765163.1| from Rhodococcus erythropolis PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226305205|ref|YP_002765163.1|
Domain Number 1 Region: 87-192
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.23e-36
Family N-utilization substance G protein NusG, N-terminal domain 0.0000426
Further Details:      
 
Domain Number 2 Region: 222-278
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.21e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226305205|ref|YP_002765163.1|
Sequence length 278
Comment transcription antitermination protein NusG [Rhodococcus erythropolis PR4]
Sequence
MSTPENDTNEALAEERVSAEAAAEVDVVVAEGTDADVAEGTDADAAATEDVISDDAENSD
EAAPAAELEVEDPVAELKAALRRAPGDWYVIHSYAGYENKVKTNLETRVQNLDVGDYIFQ
VEVPTEEVTEIKNGQRKQVNRKVLPGYILVRMELNDESWGAVRNTPGVTGFVGATSRPSP
LTLNEVVKFLLPQQEQKKQQAAAAAVAAGEAPSESFGKPLIEVDFEVGESVTVMDGPFAT
LPASISEVNGEQQKLKVLVSIFGRETPVELNFNQVAKI
Download sequence
Identical sequences A0A069J707 A0A0E4A544 A0A0U3JQ17 A0A1C4FIQ6 C0ZV29 C3JJT1 T5HPI2 U0FJC5
234621.RER_17160 gi|226305205|ref|YP_002765163.1| gi|532363833|ref|YP_008452232.1| WP_003942049.1.101405 WP_003942049.1.10702 WP_003942049.1.17328 WP_003942049.1.23831 WP_003942049.1.26240 WP_003942049.1.2937 WP_003942049.1.3260 WP_003942049.1.3298 WP_003942049.1.3447 WP_003942049.1.37275 WP_003942049.1.38104 WP_003942049.1.38653 WP_003942049.1.40047 WP_003942049.1.428 WP_003942049.1.51229 WP_003942049.1.54495 WP_003942049.1.55320 WP_003942049.1.57831 WP_003942049.1.58082 WP_003942049.1.58299 WP_003942049.1.60401 WP_003942049.1.61491 WP_003942049.1.61677 WP_003942049.1.69155 WP_003942049.1.69306 WP_003942049.1.77150 WP_003942049.1.78616 WP_003942049.1.79292 WP_003942049.1.81178 WP_003942049.1.82590 WP_003942049.1.83342 WP_003942049.1.83724 WP_003942049.1.85181 WP_003942049.1.85987 WP_003942049.1.88476 WP_003942049.1.88663 WP_003942049.1.92716 WP_003942049.1.95272 WP_003942049.1.98030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]