SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226304963|ref|YP_002764921.1| from Rhodococcus erythropolis PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226304963|ref|YP_002764921.1|
Domain Number 1 Region: 149-419
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-45
Family Protein kinases, catalytic subunit 0.00093
Further Details:      
 
Domain Number 2 Region: 529-661
Classification Level Classification E-value
Superfamily TPR-like 0.0000000165
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Weak hits

Sequence:  gi|226304963|ref|YP_002764921.1|
Domain Number - Region: 104-147
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0417
Family Transcriptional factor domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226304963|ref|YP_002764921.1|
Sequence length 785
Comment probable serine/threonine protein kinase PknG [Rhodococcus erythropolis PR4]
Sequence
MTEESGPEPDATQASVRPEPDSTQAVHREPDSTQASLRSEPEATGAYERLEPTSAQIRGT
TPSASSSPTGRSTRSRRSRSGRKLRLGGGLVEVPPVPQIDPASAVMSDPTVPERKRFCWK
CNEPVGRKSASTRATQHGTCPKCGSTFDFRPLLEEGELVSGQYEVQGPIAHGGLGWIYLA
IDRNVSDRWVVLKGLLHFGDSEAQAVAVAERQFLAEVANPSIVKIFNFVEHPRPDGTPMG
YIVMEYVGGRSLREVLAEFPDGKHMPIEQAIGYVLEILPALSYLHSTGLAYNDLKPENVM
VTEDQLKLIDLGAVSGIEDYGYLYGTAGYQAPEIIETGPTIASDIFTVGRTLAVLTLDMP
SKHGRYLDGLPEPEDEPLLRDNEFFHRLLLRATDPDPKKRFQSAEEIAGQLTGVLREILA
EQTGQENPGLSLVFSRQRTSFGTDELVGQTDVYVDGVSHDAALDPREVAHALPIPLVDPT
DPSAPLLAAAVHSEPSQTLDALKHARENGIDRTSGTPAAAISGEVRLAEAKAHLDLGDPE
TALSVLDELQQSIGDHWKIEWYRGLAALQLDRFEPAFSHFETVLTALSGEAAPKLALAAT
AELILQHWESDDPDQWCRFSEKYYRTVWRTERNYVSAAFGLARQLADHGNKKAAIAALDE
VPTSSRHYNVARMSSALTMLSGVPIAELDESTLREAARRVRALPAEESRSLQMRTLVLGT
ALDWIRYGNRSHTELEPILDLPFTEQGLRTGAEACLRALARATTSRTHRYALVDRANAVR
PRSNF
Download sequence
Identical sequences C0ZUD7
234621.RER_14740 gi|226304963|ref|YP_002764921.1| WP_020906682.1.2937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]