SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256826540|ref|YP_003150499.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256826540|ref|YP_003150499.1|
Domain Number 1 Region: 115-252
Classification Level Classification E-value
Superfamily Sortase 3.4e-41
Family Sortase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256826540|ref|YP_003150499.1|
Sequence length 307
Comment sortase, LPXTG-site transpeptidase [Cryptobacterium curtum DSM 15641]
Sequence
MATREPSGSPARVVRSSKKKRWARLQLVIAVIILLAGVALISYPFVSDWLNQRAQDAVSA
NQQEVVAALPPEDLSQEQQRAEAYNAQLFSGSSQVVDPFDTKATYLGNKEYESVLNVAGD
GVMGELFIPKINVDLPIYHYTTDESLTRGVGHVVNTSVPIGGESTHSVLAGHTGLPSARL
FDRLDELSVGDWFIIRVLGEDHAYEITSTEVVLPEEVDSIKTEAGRDLVTLVTCTPYGVN
THRLLVHAERCEVPDSWNTSEDSTIRLVATPTDLPRHLWAYALAGVLVAVAIIAVVYVIL
RYRRRQR
Download sequence
Identical sequences C7MLL1
WP_012802506.1.80809 469378.Ccur_00840 gi|256826540|ref|YP_003150499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]