SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256826940|ref|YP_003150899.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256826940|ref|YP_003150899.1|
Domain Number 1 Region: 40-220
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000000000328
Family Di-heme elbow motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256826940|ref|YP_003150899.1|
Sequence length 240
Comment hypothetical protein Ccur_04960 [Cryptobacterium curtum DSM 15641]
Sequence
MSEEKKEQETTTEQTTTEEQQAAAEPAAKKKKWPIIVGVIVIVVAVAGIGFWNWHNQPTF
CNAFCHESMNAYVETYEQDANTQGTDKWGNAVSNTNAMLAVTHKEAGVNCLGCHVPTITQ
QLTEVSETITGDYYYPLEEVGTKALQANSGHDDSSGDQFCLKSGCHDMTREDLTQATSGM
SFNPHRWQHGETECSECHKSHRASVFYCTQCHSEAAAAMPDGWVNYSEGQQLEKNSVNAS
Download sequence
Identical sequences C7MMS7
WP_012802905.1.80809 gi|256826940|ref|YP_003150899.1| 469378.Ccur_04960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]