SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256827321|ref|YP_003151280.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256827321|ref|YP_003151280.1|
Domain Number 1 Region: 45-50,89-138
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000572
Family Cytochrome c3-like 0.055
Further Details:      
 
Weak hits

Sequence:  gi|256827321|ref|YP_003151280.1|
Domain Number - Region: 7-76
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00131
Family LacY-like proton/sugar symporter 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256827321|ref|YP_003151280.1|
Sequence length 142
Comment hypothetical protein Ccur_08990 [Cryptobacterium curtum DSM 15641]
Sequence
MSDLMSQFMTPQVQSALFVFIMLLVILYVLVVVWVARDAYQRGAVWWAWSIVALVPLVGV
IAYLLLRPSLLEMDRSEQELEIALKQRELMKYGECANCGYPVQADYIICPNCHAHLKDLC
SNCHHALDPAWTVCPYCGQPQR
Download sequence
Identical sequences C7MNV8
469378.Ccur_08990 WP_012803284.1.80809 gi|256827321|ref|YP_003151280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]