SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256827358|ref|YP_003151317.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256827358|ref|YP_003151317.1|
Domain Number 1 Region: 17-123
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 2.75e-23
Family Thiamin pyrophosphokinase, catalytic domain 0.0037
Further Details:      
 
Domain Number 2 Region: 146-209
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00000589
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256827358|ref|YP_003151317.1|
Sequence length 222
Comment thiamine pyrophosphokinase [Cryptobacterium curtum DSM 15641]
Sequence
MTRFALVGAVDFNEKVFRVEHYDVLIAVDAGYATLKSRGLTPDLVVGDFDSLGYVPETEN
ILRFPHEKDESDMELAIAHACKADADEIVLYGCLSRRLDHTLANIQVMRSCAQSGVRIFG
VGCGFVLTLLAGPCRIAWEAFDPAMLDAEEYGRYLSVFALGGPAQGVTERGLLYSLENAV
LSDTASLGLSNEFTGAPAEVSVQQGDVVVIFSEDAWPTVCLP
Download sequence
Identical sequences C7MNZ5
469378.Ccur_09380 gi|256827358|ref|YP_003151317.1| WP_012803321.1.80809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]