SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256826865|ref|YP_003150824.1| from Cryptobacterium curtum DSM 15641

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256826865|ref|YP_003150824.1|
Domain Number 1 Region: 35-275
Classification Level Classification E-value
Superfamily Sortase 1.03e-43
Family Sortase 0.0000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256826865|ref|YP_003150824.1|
Sequence length 282
Comment sortase, SrtB family [Cryptobacterium curtum DSM 15641]
Sequence
MKHAAHAAIAPAAPKAKKPRRRLLWRIIFWLALIVFIGSAGVLGFYLYSYWSADRGYQDI
AAQALTSVSAQDMPADADATELADMTVDWDYLRSLNPDIVAWVVIPDTRVNYPVVQGHDN
EEYLHKDFSQKEDFGARGGAIFLEASNSPDFSDENNVLYGHHMRDGSMFACLSKDFVNGD
FFDAHRTFYVLTPEKNYKLQAFSLVLTNGWDEIVQTRFGTDDQRSAYIKDKEQRSVVAPA
GGMPDPASITQLFTLSTCDYQETNGRAVLFSSVVDTVTPSNA
Download sequence
Identical sequences C7MMK2
gi|256826865|ref|YP_003150824.1| 469378.Ccur_04190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]